Buy Sermorelin Peptide: It Is Not Growth Hormone

Summary: Four compounds get sold as one category on the same catalogue pages, and they are four different purchases. This page pins down what sermorelin is and how to confirm a vial holds it.

This content is for informational purposes only and is not medical advice. Always consult a qualified healthcare provider before starting, changing, or stopping any medication.

Buy sermorelin peptide and the word doing the most work in that phrase is peptide, because it is the part most listings gloss over. You are not buying growth hormone. You are buying a 29 amino acid fragment of the hormone that tells the pituitary to release growth hormone, which is a different molecule doing a different job at a different place in the body.

That distinction decides whether the rest of a listing makes sense. The product this page checks is on the card below.

Where readers actually buy it

Ascension Peptides — Sermorelin

Research-grade Sermorelin, assayed by an outside lab and shipped from the US. The code below takes half off the vial.

Code at checkoutPEPTIDEDECK50% off
Sermorelin · 10 mg$72.00$36.00$3.60/mgGet the 10 mg →

The published certificate for lot 38-01260229 assays this vial at 11.31 mg against a 10 mg label, and reports purity and quantity only, with no endotoxin or sterility testing. Buying 3, 5 or 10 takes 3%, 5% or 10% off the list price. Free shipping starts at $250.

  • Batch certificate published for the lot
  • Free shipping over $250
  • Ships same day if ordered before 2pm CST

Buy sermorelin peptide: what the molecule actually is

Sermorelin is a synthetic peptide identical to the active N terminal section of human growth hormone releasing hormone, written as GHRH(1-29) amide. Twenty nine residues, a C terminal amide, formula C149H246N44O42S, molecular weight 3357.9 g/mol, listed in PubChem under CID 16132413 [1]. The sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSR.

It binds the GHRH receptor on the anterior pituitary and asks that gland to release the growth hormone your body already produces. The technical word is secretagogue, which simply means something that prompts a gland to secrete. Compare that with recombinant growth hormone, which is the hormone itself, administered directly. Same conversation, opposite ends of it.

It also has a history that its shelf neighbours do not. Sermorelin was an approved American medicine, marketed by EMD Serono as Geref, with the therapeutic application NDA 020443 approved on 26 September 1997 [2]. It is now discontinued, and FDA's record carries the determination that the product was not discontinued or withdrawn for safety or effectiveness reasons [2]. No current US label exists.

Four compounds, one catalogue page, four different purchases

CompoundWhat it isWhere it actsRegulatory position
SermorelinGHRH(1-29) amide, 29 residues, 3357.9 g/molThe GHRH receptor on the anterior pituitaryApproved as Geref and now discontinued, with FDA's record stating the withdrawal was not for safety or effectiveness reasons, and absent from FDA's bulk substances risk list in every section
TesamorelinA stabilised analog of GHRHThe same GHRH receptorCurrently approved and marketed as Egrifta, which makes it the only compound in this table with a live label
IpamorelinA short synthetic peptide, unrelated in sequenceThe ghrelin receptor, a different receptor entirelyIpamorelin acetate carries a Category 2 listing under 503B
MK-677, ibutamorenAn orally active non peptide compoundThe same ghrelin receptor pathwayIbutamoren mesylate carries a Category 2 listing under both 503A and 503B, the strongest listing of any compound here

Those four are routinely stacked on the same catalogue page under a heading like growth hormone peptides, which is a category invented by retail rather than by pharmacology. Two of them are GHRH molecules and two of them are not peptides in the same sense at all, working through a separate receptor. Their regulatory positions run from a live approved label to the strongest risk listing FDA maintains [3] [4].

Buying one on the assumption that it is a variant of another is the single most common mistake in this corner of the market.

The practical fallout shows up in three places. Price comparison stops meaning anything, because a per milligram figure for a 3357.9 g/mol peptide and a per milligram figure for a small orally active molecule describe unrelated purchases. Certificates stop being comparable, because the identity evidence that confirms one compound says nothing about another. And regulatory reasoning goes badly wrong in both directions: people assume sermorelin carries the constraints that attach to ibutamoren, or they assume ipamorelin inherits sermorelin's approval history. Neither is true, and both mistakes come from treating a shelf heading as a fact about chemistry.

How to confirm a vial holds sermorelin

Four checks, none of which needs a laboratory.

The mass. Sermorelin is 3357.9 g/mol. That is a large, distinctive number for a peptide, and a certificate reporting a mass spectrometric result should land on it. Ipamorelin and MK-677 are far lighter molecules and cannot be mistaken for it on mass alone.

The formula. C149H246N44O42S. One sulphur, from the single methionine in the sequence. A certificate reporting a different formula is describing a different substance.

The sequence. Twenty nine residues, ending in a C terminal amide, reading YADAIFTNSYRKVLGQLSARKLLQDIMSR. Some certificates print it, and where they do it is the most direct confirmation available to a buyer. The document published for the listing here prints a sequence that converts to exactly that, which is why we can say the vial holds the compound the label names rather than assuming it.

The public record. PubChem CID 16132413 returns the title Sermorelin with that formula and that mass [1]. Two minutes with a certificate and that page settles identity.

What none of those four checks does is tell you how much of the vial is that compound, which is the purity question, or how much material is in the vial at all, which is the quantity question. Identity, purity and quantity are three separate results, and a certificate that reports one of them confidently is not reporting the other two by implication.

For the listing on this page, those checks pass. The certificate is from MZ Biolabs of Tucson, Arizona, covering lot 38-01260229, analysed on 7 February 2026 by HPLC-UV-MS, reporting 99.79 percent purity across four detected peaks and 11.31 mg measured against a 10 mg label.

Why identity matters more for this compound than for most

Because the marketing does not distinguish, and the pharmacology does.

A page selling sermorelin for adult vitality, a page selling ipamorelin for the same thing and a page selling MK-677 for the same thing will use nearly identical language, and the reader is left assuming three routes to one outcome. In fact they are three molecules, two receptors and three different regulatory positions.

The evidence position is worth stating alongside that. PubMed returns 332 papers mentioning sermorelin, three with the word in the title, and zero for sermorelin paired with anti ageing. ClinicalTrials.gov registers no studies naming the compound, and a registry search that appears to return some is showing GHRH, tesamorelin and octreotide trials instead. Sermorelin is GHRH(1-29), so some GHRH literature is genuinely adjacent, but an adjacent literature is not the same as a trial of the thing in the vial. The approved indications were paediatric growth hormone deficiency and pituitary function testing.

The criteria for choosing a supplier once identity is settled are on sermorelin where to buy, the costing is on sermorelin price, and the supervised route is on how to get a sermorelin prescription. If you arrived here from the GLP-1 side of this site, the same identity discipline is why we insist on knowing exactly which molecule a compounded vial contains.

Common questions about buying sermorelin peptide

Is sermorelin the same as HGH?
No. Growth hormone is the hormone. Sermorelin is a 29 residue fragment of the releasing hormone upstream of it, so it acts on the pituitary and prompts release of what your body already makes rather than supplying the hormone directly.
What is the difference between sermorelin and tesamorelin?
Both are GHRH molecules acting at the same receptor, but tesamorelin is a stabilised analog and is currently approved and marketed as Egrifta. Sermorelin was approved as Geref and is discontinued, with no current US label.
Is ipamorelin just a cheaper sermorelin?
No, and it is not the same class. Ipamorelin acts at the ghrelin receptor rather than the GHRH receptor, and ipamorelin acetate carries a Category 2 listing under 503B. Different molecule, different receptor, different regulatory standing.
How can I tell a vial holds sermorelin and not something else?
Check the certificate against the public record. Sermorelin is 29 residues, formula C149H246N44O42S, mass 3357.9 g/mol, PubChem CID 16132413. A printed sequence is the strongest single confirmation, and a mismatched mass or formula settles it immediately.
Does 99.79 percent purity confirm identity?
Not on its own. Purity says what proportion of the material is the intended compound, which presupposes the intended compound has been identified. The identity evidence is the sequence, the formula and the mass, reported separately.

The short version

Buying a sermorelin peptide means buying GHRH(1-29) amide: 29 residues, 3357.9 g/mol, C149H246N44O42S, PubChem CID 16132413, acting on the pituitary rather than replacing a hormone. It is not HGH, it is not ipamorelin and it is not MK-677, and the fact that all four appear on the same catalogue page is a retail decision rather than a pharmacological one. Confirm identity from the certificate against the public record before anything else, then read what else that certificate does and does not cover. For this lot, that means purity and quantity and nothing about endotoxin or sterility.

References

  1. PubChem, Sermorelin, CID 16132413, C149H246N44O42S, 3357.9 g/mol
  2. FDA, Drugs@FDA, Geref (sermorelin acetate), NDA 020443, EMD Serono, original approval 26 September 1997, marketing status Discontinued
  3. FDA, Bulk Drug Substances Used in Compounding Under Section 503A of the FD&C Act, category lists
  4. FDA, Bulk Drug Substances Used in Compounding Under Section 503B of the FD&C Act